PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000215359
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family MYB
Protein Properties Length: 485aa    MW: 55103.1 Da    PI: 6.9747
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000215359genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding61.32.1e-19215261148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g WTteEd ll+++v+q+G + W+ Ia++++ gR +kqc++rw+++l
    MDP0000215359 215 KGQWTTEEDRLLIQLVEQFGVRKWSHIAQMLP-GRIGKQCRERWHNHL 261
                      799*****************************.*************97 PP

2Myb_DNA-binding574.5e-18267309145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      ++ W++eEd+ l++a+++ G++ W+ Ia++++ gRt++++k++w+
    MDP0000215359 267 KDTWSEEEDKTLIQAHAEIGNK-WAEIAKRLP-GRTENSIKNHWN 309
                      679*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129430.554210265IPR017930Myb domain
SuperFamilySSF466894.67E-32212308IPR009057Homeodomain-like
SMARTSM007174.2E-18214263IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.8E-27216267IPR009057Homeodomain-like
CDDcd001671.14E-16218261No hitNo description
PfamPF139214.7E-20218278No hitNo description
SMARTSM007172.8E-17266314IPR001005SANT/Myb domain
PROSITE profilePS5129421.694266316IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.2E-22268314IPR009057Homeodomain-like
CDDcd001671.65E-13269312No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010183Biological Processpollen tube guidance
GO:0045697Biological Processregulation of synergid differentiation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 485 aa     Download sequence    Send to blast
MELNKLRKKL VSQIHIPLFA SENYVKPYAM KDEFLFETSS SSKRNYNYLQ DFHHLDHQFH  60
VNVSSSNPMF GTHTPCFDPY SDTSYPYDQN SSHQDVNFYK CKPPNVAENN GGHGQVLDNF  120
QGGSYLNFPT HHRSSNPFDH AVGTSSHGSA TNFLPLDCTQ DIKPMNFSVP DEVSCINNAD  180
QNGYYRKFGM NGKSKVTGVT RGSMVKGRKK SNVVKGQWTT EEDRLLIQLV EQFGVRKWSH  240
IAQMLPGRIG KQCRERWHNH LRPDIKKDTW SEEEDKTLIQ AHAEIGNKWA EIAKRLPGRT  300
ENSIKNHWNA TKRRQYSKRK CRSKYPRGSI LQEYIKSLNL DSASNSTGRQ RRNSSANNNN  360
GGSTSTKAAA AAATYQQPQT NVGLLCANDL LVPSYNDFNE DPDFCFDENI FEEGCSIDSL  420
LDDIPCAAAV GEKNSNFDGY NEIDYGYVDK GNFDEKDFQM AMQVDLESNE VKKEMDLVEM  480
ISQVN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C8e-462133152104C-Myb DNA-Binding Domain
1msf_C8e-462133152104C-Myb DNA-Binding Domain
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00442DAPTransfer from AT4G18770Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008374889.10.0PREDICTED: transcription factor MYB98-like
SwissprotQ9S7L21e-101MYB98_ARATH; Transcription factor MYB98
TrEMBLM5WSR40.0M5WSR4_PRUPE; Uncharacterized protein
STRINGGLYMA05G02300.21e-158(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15703196
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18770.13e-98myb domain protein 98